Peptide 2MG Sermorelin pentru pierderea in greutate

Sermorelin CAS 86168-78-7 2 mg Sermorelin Acetat pentru pierderea în greutate
Nume produs: Sermorelin
CAS: 86168-78-7
MF: C149H246N44O42S
MW: 3357,88
Vorbeste acum

Detalii produs

Sermorelin CAS 86168-78-7 2 mg Sermorelin Acetat pentru pierderea în greutate

Nume produs: Sermorelin
Sinonime: SERMORELIN; SERMORELIN ACETAT; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2; TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER -Lys-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2; TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-Gli -GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN H-TYR-ALA-ASP- SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-GLU-ASP-ILE-MET-SER-ARG-NH2 -29), AMIDE, UMAN, GRF (1-29) AMIDE (UMAN)
CAS: 86168-78-7
MF: C149H246N44O42S
MW: 3357,88


Utilizarea inhibitorului xantin oxidazei

Aplicații Sermorelin:

- Creșterea dezvoltării masei corporale slabe prin dezvoltarea de noi celule musculare
- Reduce grăsimea corporală prin lipoliză
- Creste energia si vitalitatea
- Creste puterea
- Creste rezistenta
- Accelerează vindecarea de la răni sau intervenții chirurgicale
- Intareste inima
- Îmbunătățește sistemul imunitar
- Creșterea producției IGF-1
- Îmbunătățește calitatea somnului
- Creste retentia de calciu si intareste si creste mineralizarea densitatii osoase sau osoase.
- Creste sinteza proteinelor si stimuleaza cresterea tuturor organelor interne, cu exceptia creierului.


Peptida acetatului Sermorelin și HGH

Acetat de sermorelin, care are o structură similară cu CJC-1295, este un hormon sintetic bio-identic, care este extrem de eficient în creșterea cantității de HGH. Hormonul de creștere uman este un hormon eliberat de organism care controlează reproducerea și creșterea celulelor și a fiecăruia dintre organele din organism. La o vârstă fragedă, producția de HGH a organismului este cea mai activă, în timp ce rata de creștere este la cel mai înalt punct. După vârsta de 30 de ani, pentru fiecare deceniu de viață, există o reducere cu 14% a producției de HGH. Până la vârsta de 40 de ani, producția de HGH este de aproximativ 40% din ceea ce avea la vârsta de 20 de ani. Odată cu dezvoltarea ulterioară a factorilor de eliberare a hormonului de creștere (GHRF), cum ar fi GRF modificat 1-29, stimularea glandei hipofizare.


MGF, 2 mg

PEG MGF, 2 mg

CJC-1295 DAC, 2 mg

CJC-1295, 2 mg

PT141, 10 mg

Melanotan-2, 10 mg

GHRP-2, 10 mg

GHRP-6, 10 mg

GHRP-2, 5 mg

GHRP-6, 5 mg

Ipamorelin, 2 mg

Hexarelin, 2 mg

Sermorelin, 2 mg

Oxitocină, 2 mg

TB500, 2 mg

HGH 176-191, 2 mg

Triptorelin, 2 mg

Tesamorelin, 2 mg

Gonadorelin, 2 mg

Gonadorelin, 10 mg

DSIP, 2mg

Selank, 5 mg

BPC 157, 2 mg

Epitalon, 10 mg

Follistatin 344, 1 mg

AOD-9604, 2 mg

Deslorelin, 20 mg

IGF-1 LR3, 0,1 mg

Follistatin 315, 1 mg

Dermorfin, 10 mg

Thymosin α1 Acetat, 10 mg

ACE 031, 1 mg

GDF-8, 1 mg


图片23.jpg

Hot Tags: peptide 2 mg sermorelin pentru scădere în greutate, China, furnizori, cu discount, cumpărare, vrac, cotație, calitate hiGH, în stoc

Anchetă

You Might Also Like